settings Currency keyboard_arrow_down
GBPAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
menu
phoneemail
shopping_cart Basket (0)
Special Offers
location_on
Kitty Cat with Dangling Blue Fish Pin
Kitty Cat with Dangling Blue Fish Pin Kitty Cat with Dangling Blue Fish Pin Kitty Cat with Dangling Blue Fish Pin Kitty Cat with Dangling Blue Fish Pin

Kitty Cat with Dangling Blue Fish Pin

Product Code:  CAT7
Product Description
Little Black and White Kitty Cat with Dangling Blue Fish Charm Pin cutest ever!

Fun Cute and Quirky Jewellery.

It measures approx 4 x 2 cm. 


/ᐠ .ᆺ. ᐟ\ﾉ



£5.99 inc. tax
Add to Cart Quantity
Product Details
Product Condition: New
Product Description
Related Products
Featured Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i